Fusarium poae: FPOAC1_006268 Help Entry FPOAC1_006268     CDS       T09519                                  Name (RefSeq) hypothetical protein   KO K07937   ADP-ribosylation factor 1/2 Organism fpoa  Fusarium poae Pathway fpoa04144   Endocytosis Brite KEGG Orthology (KO) [BR:fpoa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     FPOAC1_006268  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fpoa04131]     FPOAC1_006268   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fpoa04147]     FPOAC1_006268    04031 GTP-binding proteins [BR:fpoa04031]     FPOAC1_006268 Membrane trafficking [BR:fpoa04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     FPOAC1_006268   Arf GTPases and associated proteins    Arf GTPases     FPOAC1_006268  Endosome - Golgi transport     FPOAC1_006268 Exosome [BR:fpoa04147]  Exosomal proteins   Proteins found in most exosomes    FPOAC1_006268 GTP-binding proteins [BR:fpoa04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     FPOAC1_006268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB MMR_HSR1 Roc AAA Ras DO-GTPase2 G-alpha 6PF2K Lipase_GDSL_3 AAA_22 Motif Other DBs NCBI-GeneID:  68341271 NCBI-ProteinID:  XP_044709465 LinkDB All DBs Position 2:complement(6713168..6713568) Genome browser AA seq 114 aa AA seqDB search MGAAISRLWTPPIIQVGFVGLPSTGKTAIIHKLSQGQKPTLPLTDTVNTTRFFRGSQEYC IFDYSGNEKLRAIWRKLLFRMQAIVFVIDSTDRANKEETREALWQVLREEMLDP NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgggggctgctatctctcgattgtggacacctcctatcatccaagttggctttgttgga ctgccctcaactggcaagaccgctatcattcacaagctcagtcaaggccagaaaccaaca ctgccactaaccgacactgttaataccacacgcttctttcgaggttctcaagagtactgc atcttcgactactctggaaacgagaaactgagagcaatatggagaaagcttctattccga atgcaggctattgtctttgtcatcgatagcacggatagagcgaacaaggaggaaactagg gaggcgctatggcaagtattacgagaggaaatgcttgatccttag

DBGET integrated database retrieval system