Fusarium poae: FPOAC1_006472 Help Entry FPOAC1_006472     CDS       T09519                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism fpoa  Fusarium poae Pathway fpoa03020   RNA polymerase fpoa03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fpoa00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FPOAC1_006472   09124 Replication and repair    03420 Nucleotide excision repair     FPOAC1_006472  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fpoa03021]     FPOAC1_006472    03400 DNA repair and recombination proteins [BR:fpoa03400]     FPOAC1_006472 Transcription machinery [BR:fpoa03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FPOAC1_006472   RNA polymerase III system    RNA polymerase III      FPOAC1_006472   RNA polymerase I system    RNA polymerase I      FPOAC1_006472 DNA repair and recombination proteins [BR:fpoa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FPOAC1_006472 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD YjdM_Zn_Ribbon zinc_ribbon_9 Zn-ribbon_8 zf-C2HC5 Zn_Tnp_IS1595 DnaJ_CXXCXGXG HypA Motif Other DBs NCBI-GeneID:  68341475 NCBI-ProteinID:  XP_044709665 LinkDB All DBs Position 2:7244370..7244642 Genome browser AA seq 72 aa AA seqDB search MPREEYQIPTASAGQRGGTRDDHQVRHVMSYICGDCGGSVTLGKDALVACPHCAGRILYK ERTKRMVQFEAR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgcctcgcgaagagtaccaaatccctaccgcctctgctggccagcgtggcggtacccgc gatgatcaccaggttcgccatgtcatgtcctacatctgcggcgactgcggtggcagcgtc accctcggcaaggatgctcttgtcgcctgccctcactgcgccggtcgcattctctacaag gagcgaactaagcgtatggtgcagttcgaagcccgatag

DBGET integrated database retrieval system