Frischella perrara: FPB0191_01919 Help Entry FPB0191_01919     CDS       T03525                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism fpp  Frischella perrara Pathway fpp01100   Metabolic pathways fpp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fpp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPB0191_01919    00074 Mycolic acid biosynthesis     FPB0191_01919   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPB0191_01919 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AJA45730 UniProt:  A0A0A7S2F5 LinkDB All DBs Position 2185694..2185954 Genome browser AA seq 86 aa AA seqDB search MFSLQEEIKQIIIDTLNLEEMTANDIETEMPLFGDGLGLDSIDALELGLAIKNRYGIVLS TEDEKTKQIFYSVKTLADFISSQQNQ NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgttctcgttacaagaagaaataaaacagatcatcattgatactttaaatttagaagaa atgacagctaatgatattgaaaccgaaatgcctttatttggcgatggcttaggtctggat tccatagatgccttggaattaggtttagctattaaaaatcgttatggcatagtgttatca accgaagatgaaaaaacaaaacaaattttctattcagttaaaacattagctgatttcata tcttcacaacaaaatcaatag

DBGET integrated database retrieval system