Flavobacterium psychrophilum 950106-1/1: IB65_10090 Help Entry IB65_10090        CDS       T03412                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fpq  Flavobacterium psychrophilum 950106-1/1 Brite KEGG Orthology (KO) [BR:fpq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fpq03032]     IB65_10090    03036 Chromosome and associated proteins [BR:fpq03036]     IB65_10090    03400 DNA repair and recombination proteins [BR:fpq03400]     IB65_10090 DNA replication proteins [BR:fpq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IB65_10090 Chromosome and associated proteins [BR:fpq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IB65_10090 DNA repair and recombination proteins [BR:fpq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IB65_10090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  AIT66185 UniProt:  Q597A8 LinkDB All DBs Position complement(2163131..2163406) Genome browser AA seq 91 aa AA seqDB search MNKSDLIDAMSASAGITKAAAKLALESFLGNIEETLQKGGRVSLVGFGSWSVSNRAARDG RNPQTGATIKIAAKNVVKFKAGAELEIAVNK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatcagatttaatcgatgcaatgtcagcttcagctggaattacaaaagctgct gccaaattagccttagaatcatttttaggcaatattgaagaaactttgcaaaaaggtgga agagtttctctagttggatttggatcttggtctgtatctaacagagctgcaagagacgga agaaacccacaaacaggagcaacaattaaaattgctgctaaaaacgtagtgaaatttaaa gcaggtgctgaattagaaatagcagtaaataaataa

DBGET integrated database retrieval system