Faecalibacterium prausnitzii L2-6: FP2_15810 Help Entry FP2_15810         CDS       T02591                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fpr  Faecalibacterium prausnitzii L2-6 Pathway fpr01100   Metabolic pathways fpr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fpr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FP2_15810    00074 Mycolic acid biosynthesis     FP2_15810   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FP2_15810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CBK99053 UniProt:  D4JYF4 LinkDB All DBs Position 1571032..1571265 Genome browser AA seq 77 aa AA seqDB search MDTFEKIRALLAEQLDIDPAKITMDSDIMGDFEADSLDIVDMVMTLEDEFGIEVPDDAIE NLRTVGDVVKFVDSHKG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggatacgtttgagaagatccgcgcactgctggcagaacagctggacatcgaccccgct aagatcacgatggacagtgacattatgggcgattttgaggccgacagcctcgacatcgtg gatatggtgatgacgctggaggatgagtttggcatcgaggtgccggacgacgccatcgag aacctgcgcacggtgggtgatgtggtgaagtttgtggacagccacaagggctga

DBGET integrated database retrieval system