Faecalibacterium duncaniae A2165: CG447_03580 Help Entry CG447_03580       CDS       T06780                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fpra  Faecalibacterium duncaniae A2165 Pathway fpra01100   Metabolic pathways fpra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fpra00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CG447_03580 (acpP)    00074 Mycolic acid biosynthesis     CG447_03580 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CG447_03580 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Toxin_10 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ATO99058 UniProt:  A0A1Q6QVM5 LinkDB All DBs Position complement(687326..687559) Genome browser AA seq 77 aa AA seqDB search MDTFEKIRALLAEQLDIDPAKITMESDIMSDFEADSLDIVDMVMTLEDEFGIEVPDDAIE NLRTVGDVVEFVDSHKG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggatacttttgaaaagatccgtgcactgctggcagagcagctggatattgaccctgct aagatcacgatggagagcgacattatgagtgatttcgaggccgacagcctggatatcgtg gacatggtgatgacgctggaggatgagtttggcattgaggtgccggacgatgccatcgag aatctgcgcaccgtgggcgacgtggtggaatttgtggacagccacaagggctga

DBGET integrated database retrieval system