Faecalibacterium duncaniae A2165: CG447_12800 Help Entry CG447_12800       CDS       T06780                                  Name (GenBank) chemotaxis protein   KO K03116   sec-independent protein translocase protein TatA Organism fpra  Faecalibacterium duncaniae A2165 Pathway fpra03060   Protein export fpra03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:fpra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CG447_12800  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CG447_12800  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:fpra02044]     CG447_12800 Secretion system [BR:fpra02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CG447_12800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  T3SS_needle_F DUF6317 Motif Other DBs NCBI-ProteinID:  ATP00712 LinkDB All DBs Position 2596122..2596406 Genome browser AA seq 94 aa AA seqDB search MAQAKQPGRDKSLASLHKATDTLSTMLAQEVKELNARQKAQRGDGSDPALMKGLKEATAV LKDLAAVAKTLNDQGADAEARACGVVLLPAVEDV NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagcaaaacagccgggcagggacaagagccttgccagcctgcacaaggccacc gacaccctgagcaccatgctggcgcaggaggtcaaggaactgaacgcccggcagaaggcc cagcgtggcgatggctctgaccccgccctgatgaaggggctcaaggaggctacggcggtg ctgaaggatctggctgcggtggccaagaccctgaatgatcagggtgcggatgccgaggcc cgggcgtgcggcgtggtgcttctgccagccgtggaggacgtatga

DBGET integrated database retrieval system