Fusarium pseudograminearum: FPSE_02973
Help
Entry
FPSE_02973 CDS
T03456
Name
(RefSeq) hypothetical protein
KO
K27383
non-classical export protein 1
Organism
fpu
Fusarium pseudograminearum
Brite
KEGG Orthology (KO) [BR:
fpu00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
fpu02000
]
FPSE_02973
Transporters [BR:
fpu02000
]
Other transporters
Others
FPSE_02973
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NCE101
Motif
Other DBs
NCBI-GeneID:
20361592
NCBI-ProteinID:
XP_009254367
UniProt:
K3VNQ5
LinkDB
All DBs
Position
3:4045439..4045674
Genome browser
AA seq
59 aa
AA seq
DB search
MPAAPAYIISRVADPIFGVLIGLSAAATRINREEKDKGRTTQQTLEDARRRVGLSSKSS
NT seq
180 nt
NT seq
+upstream
nt +downstream
nt
atgcctgctgcaccagcatacatcatctctcgcgttgcagacccgattttcggtgttctg
atcggcctctcagcagctgccaccagaatcaatcgtgaggagaaggacaaaggtcgaaca
actcaacagacccttgaagatgcccgacgacgagtgggactttcttccaagtcttcttaa
DBGET
integrated database retrieval system