Fusarium pseudograminearum: FPSE_10158 Help Entry FPSE_10158        CDS       T03456                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism fpu  Fusarium pseudograminearum Pathway fpu00510   N-Glycan biosynthesis fpu00513   Various types of N-glycan biosynthesis fpu01100   Metabolic pathways fpu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fpu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     FPSE_10158    00513 Various types of N-glycan biosynthesis     FPSE_10158  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     FPSE_10158 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  20368775 NCBI-ProteinID:  XP_009261550 UniProt:  K3V8M9 LinkDB All DBs Position 3:5795632..5795940 Genome browser AA seq 71 aa AA seqDB search MITDGQLYQLAIFFGVAAMLLILVYHFLEVNAPENTAANGKEGASKRTLRKIEPRIHNKE LGLNMTRSGAV NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgattaccgacggccagctctatcaactagccatcttcttcggcgtcgcggcaatgctt ctcatcctcgtctaccacttcctcgaagtcaacgccccggagaacacagctgcaaatggg aaggagggagcttcaaagagaactcttcgaaagatcgaaccacgtatccacaacaaagag cttgggctcaacatgaccagatcaggggctgtatag

DBGET integrated database retrieval system