Fusarium pseudograminearum: FPSE_11217 Help Entry FPSE_11217        CDS       T03456                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism fpu  Fusarium pseudograminearum Pathway fpu03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:fpu00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     FPSE_11217  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fpu03036]     FPSE_11217    03400 DNA repair and recombination proteins [BR:fpu03400]     FPSE_11217 Chromosome and associated proteins [BR:fpu03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      FPSE_11217 DNA repair and recombination proteins [BR:fpu03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      FPSE_11217 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-18kDa Histone TAF TFIID-31kDa DUF7605 Motif Other DBs NCBI-GeneID:  20369834 NCBI-ProteinID:  XP_009262609 UniProt:  K3V9E5 LinkDB All DBs Position 4:2703417..2703891 Genome browser AA seq 113 aa AA seqDB search MADTTGDENRERLKAALWYAVGQIVDEESLRRNRNATPQFIGALTELVWTQIENIATDLE SFSNHAGRSTVTTDDVLLLARKNPDLHQIMKEFVDQAKAEKGTSKARRGASKR NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcagatacaacaggcgatgaaaatagagagcgtctcaaggctgcactgtggtacgcc gttggccaaatcgtcgatgaagagtccctccgtcgcaaccgcaacgccacaccgcaattc atcggtgcactcacagaacttgtttggacgcaaattgagaatattgccacggatctagag agtttcagcaatcatgcaggtcgctcaaccgtcacaacagatgacgtgctgcttcttgcg aggaagaatcctgatttacatcaaatcatgaaggaattcgttgatcaagccaaggcggag aagggaacctccaaggccagacgaggtgcaagcaaacgatag

DBGET integrated database retrieval system