Fusarium pseudograminearum: FPSE_11666 Help Entry FPSE_11666        CDS       T03456                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism fpu  Fusarium pseudograminearum Pathway fpu04814   Motor proteins Brite KEGG Orthology (KO) [BR:fpu00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     FPSE_11666  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fpu03037]     FPSE_11666    04812 Cytoskeleton proteins [BR:fpu04812]     FPSE_11666 Cilium and associated proteins [BR:fpu03037]  Motile cilia and associated proteins   Dynein arm    FPSE_11666 Cytoskeleton proteins [BR:fpu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      FPSE_11666 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light SGTA_dimer Motif Other DBs NCBI-GeneID:  20370283 NCBI-ProteinID:  XP_009263058 UniProt:  K3V5J1 LinkDB All DBs Position 1:2803837..2804523 Genome browser AA seq 103 aa AA seqDB search MADAHAPKAESPIPREKLEAQIKSADMTEDMQQESIEVAQEAMAKFTIEKDIAQHIKRTF DERKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggccgacgctcacgctcccaaggcagagtctcccattccccgggagaagctcgaggct cagatcaagtccgccgacatgacggaggacatgcaacaagagtccattgaagttgctcag gaggctatggccaagttcaccattgaaaaggacatcgcacagcacatcaagcgaaccttc gacgagcgaaagggacctacctggcactgcattgttggtcgcaactttggcagcttcgtc actcacgagaccaagcacttcatctacttctaccttggccactgcgcaattttactattc aaaacgcaatag

DBGET integrated database retrieval system