Fusarium pseudograminearum: FPSE_11738 Help Entry FPSE_11738        CDS       T03456                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism fpu  Fusarium pseudograminearum Pathway fpu03083   Polycomb repressive complex fpu04111   Cell cycle - yeast fpu04120   Ubiquitin mediated proteolysis fpu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fpu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     FPSE_11738    04120 Ubiquitin mediated proteolysis     FPSE_11738   09126 Chromosome    03083 Polycomb repressive complex     FPSE_11738  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     FPSE_11738  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fpu04131]     FPSE_11738    04121 Ubiquitin system [BR:fpu04121]     FPSE_11738    03036 Chromosome and associated proteins [BR:fpu03036]     FPSE_11738 Membrane trafficking [BR:fpu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     FPSE_11738 Ubiquitin system [BR:fpu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      FPSE_11738    Cul7 complex      FPSE_11738 Chromosome and associated proteins [BR:fpu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      FPSE_11738   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      FPSE_11738 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Trnau1ap Motif Other DBs NCBI-GeneID:  20370355 NCBI-ProteinID:  XP_009263130 UniProt:  K3V4C0 LinkDB All DBs Position 4:complement(1820412..1821092) Genome browser AA seq 169 aa AA seqDB search MSESTSPQKVWLASNDSANIEVDRVVAERSMLIKNMLEDVGDEITQGNPIPIPNVNEAVL RKVIEWCDHHRNDPPQAQDDESDARKKTTDIEEWDQKFMQVDQEMLFEIILASNYLDIKP LLDVGCKTVANMIKGKAPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgtctgagtctacatctcctcagaaggtttggctggcctctaatgacagcgccaacatc gaagtcgaccgcgttgtcgctgagcgatcaatgctgatcaagaacatgctcgaggatgtt ggtgacgaaatcacccagggcaaccctattcctattcccaacgtcaacgaggcagtcctc cgcaaggttatcgagtggtgcgaccaccaccgaaacgatcctcctcaggctcaggatgat gaatccgacgctcgcaagaagaccaccgacatcgaggagtgggaccagaagttcatgcag gtcgatcaggagatgctcttcgagattatcctcgcctctaactacctcgatatcaagccc cttctcgacgtcggatgcaagaccgtcgccaacatgatcaagggcaaggcacccgaggag atccgcaagaccttcaatatcaccaacgatttcacccccgaagaggaggagcagatccgc cgtgagaacgagtgggctgaggaccgctaa

DBGET integrated database retrieval system