Frankia casuarinae: Francci3_4147 Help Entry Francci3_4147     CDS       T00320                                  Name (GenBank) phosphopantetheine-binding   KO K05553   minimal PKS acyl carrier protein Organism fra  Frankia casuarinae Pathway fra00253   Tetracycline biosynthesis fra01056   Biosynthesis of type II polyketide backbone fra01100   Metabolic pathways fra01110   Biosynthesis of secondary metabolites Module fra_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:fra00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     Francci3_4147    00253 Tetracycline biosynthesis     Francci3_4147  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:fra01004]     Francci3_4147    01008 Polyketide biosynthesis proteins [BR:fra01008]     Francci3_4147 Lipid biosynthesis proteins [BR:fra01004]  Polyketide synthase   Component type    Francci3_4147 Polyketide biosynthesis proteins [BR:fra01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      Francci3_4147     Nonaketide PKS      Francci3_4147     Decaketide PKS      Francci3_4147 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABD13495 UniProt:  Q2J5E7 LinkDB All DBs Position complement(4947971..4948267) Genome browser AA seq 98 aa AA seqDB search MNSRPMTIDDLRRVLREGAGAEEGIDLDGDILDTSFESLGYDSLALLETTSRIANEYGVK LSDDAATSARTPRELLELVNVGSGGVVVGGGADADRLL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaattcccggccaatgactatcgatgatctgcgacgtgttcttcgcgagggtgccggc gccgaggaggggatcgatctcgacggcgacatcctggacacgtcgttcgaaagcctcgga tacgactctctggcccttctggaaacgacgtcccggattgccaacgagtacggggtgaag ctttccgacgacgccgcgacgagcgcgcggacgccccgggagctgctcgagcttgtcaat gtcggcagcggcggcgtcgtggtcggcggcggcgcggacgcggaccgcctgctctga

DBGET integrated database retrieval system