Parafrankia sp. EAN1pec: Franean1_5978
Help
Entry
Franean1_5978 CDS
T00608
Name
(GenBank) conserved hypothetical protein
Organism
fre
Parafrankia sp. EAN1pec
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
ABW15322
LinkDB
All DBs
Position
complement(7284437..7285354)
Genome browser
AA seq
305 aa
AA seq
DB search
MGRWSAHPTDRPDEVGIVVVVQIGGRNVATNDVGIMAAGAVAFIFSFLAWFSLKGDFFGS
SYSDSASAWNTDVGGWFWGWLAILLLLAVAGLTAALTFVANLRLPTLPVPLPLVLTGASG
LAVLLILIRWIAYPKIPEGFEGGASYGLFIGLIAAIAQTVFGVLNIRSGSGVTGQPPQPG
GWPGQGQPPYGQPPAGYGQPYGQQPPAGYGQQPPAGYGQQPPAGYGQPPPAGGYGQQPPT
GGYGQPPQGGYGQQQGDYGQRPGYGQQPPAGYGQPPPAGGYGQQPPTGGYGQPPQGGYGQ
PPSDR
NT seq
918 nt
NT seq
+upstream
nt +downstream
nt
gtgggacgatggtcggcccacccgaccgaccgacctgacgaagtggggattgttgtcgtg
gtacagattggtggtcgtaacgtcgcgaccaacgacgtcgggatcatggccgccggcgcc
gtagcgttcatcttcagcttcctggcgtggttctcgctcaagggcgacttcttcggctcg
tcctattccgacagcgcgagcgcgtggaacaccgacgtcggtggctggttctggggatgg
ctcgccatcctcctcctcctcgcggtcgcggggctgaccgctgccctcacgttcgtcgcc
aatctccgcctcccgacgctcccggtcccgctcccgctggtcctgaccggtgcatccggg
ctcgccgtgctgctgattctgatccgttggatcgcctaccccaagattcctgaaggcttt
gagggcggcgcttcgtacggcctgttcatcgggctgatcgcggccatcgcgcagacggtg
ttcggggtactgaacatccgttccggttctggtgtcacgggccagccgccgcagcccggg
ggctggccgggtcagggccagcccccgtacggccagccgcccgccgggtacggccagccc
tacggccagcagccgccggccggttacgggcagcagccgccggccgggtacggccagcag
ccgccggccggttacgggcagccgccgccggccggtggttacgggcagcagccgcccacg
ggcgggtacggccagccgccgcagggcggttacggccagcagcagggcgactatggtcag
cggcccgggtacggccagcagccgccggccggttacgggcagccgccgccggccggtggt
tacgggcagcagccgcccacgggcgggtacggccagccgccgcagggcggttacggccag
ccgccgtcggatcgctag
DBGET
integrated database retrieval system