Candidatus Francisella endociliophora: LO80_08895 Help Entry LO80_08895        CDS       T03403                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism frf  Candidatus Francisella endociliophora Pathway frf01100   Metabolic pathways frf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:frf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LO80_08895    00074 Mycolic acid biosynthesis     LO80_08895   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LO80_08895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AIT10074 UniProt:  A0A097ER92 LinkDB All DBs Position complement(1809628..1809870) Genome browser AA seq 80 aa AA seqDB search MSANEVYAKVNSIIVEQLGVKEEDLKPEASFIDDLGADSLDTVELVMALEEEFDTEIPDE DAEKIRTVKDVYDYIDSKVN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgcaaatgaagtatatgctaaagtaaactcaatcatcgttgaacaacttggtgtt aaagaagaagatcttaaaccagaagcttctttcattgatgacttaggagctgattcttta gatacagttgaattagttatggctctagaagaagaatttgatacagaaattcctgatgaa gatgctgaaaaaatcagaacagtaaaagacgtttacgactatattgattctaaagtaaac taa

DBGET integrated database retrieval system