KEGG   Pseudofrankia inefficax: FraEuI1c_4230
Entry
FraEuI1c_4230     CDS       T01354                                 
Name
(GenBank) Taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
fri  Pseudofrankia inefficax
Pathway
fri00430  Taurine and hypotaurine metabolism
fri00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    FraEuI1c_4230
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FraEuI1c_4230
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     FraEuI1c_4230
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: ADP82229
UniProt: E3JAN7
LinkDB
Position
5127866..5128894
AA seq 342 aa
MSTALLRRNRTAPTEESDMPSVTDDRRSPATAQPAAARASRNGAGIRGTTDSAAWRVERL
TPRIGARLDGLDLRTLPRSGRAEELRTALVAHKVLFVPGQDLDADDHVALGRALGDVTTS
HPVVPGADERHPEIYELDSHDGGTSDVWHTDVTFMPRPPMASILRAVRLPDLGGATNWVD
LEQAYESLSPAVRALADGLEAIHDGNREFGEYLAHRRGGEGNDWDGTRVRALVPVRHPVV
RVHPETGRRSLFVNPGFTVRIAGVSDAESRGLLDIFFAHLTRPEHLVRHHWRPGDVVLWD
NRSTAHYADHDYGDFQRIMHRITLRGDIPVGPDPAARPSART
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgtcaaccgcgctgttgcggaggaaccggaccgcgccgaccgaggagagcgacatgccg
agcgtcaccgacgaccgccgttcacccgccacggcccagccagcggccgcgcgagcctcg
cggaacggcgccggcatccgcggtaccacggacagcgcggcctggcgggtggagcggctc
acccctcggatcggcgcgcgcctcgacggcctggacctgcggacgctgccgcgttccggc
cgggccgaggagctgcgcacggccctcgtcgcccacaaggtgctgttcgtcccgggtcag
gatctcgacgctgacgaccacgtcgcgctgggccgggcgctgggcgacgtgacgacctcg
catccggtcgtcccgggagccgacgagcggcaccccgagatctacgagctggacagccac
gacggcggaacatccgacgtctggcacaccgacgtcacgttcatgccccgaccgcccatg
gcgtcgatcctgcgggcggtgcggctgcccgacctcggcggcgccacgaactgggtggac
ctggaacaggcctacgagtcgctctcaccggcggtgcgcgcgctcgcggacgggctggag
gccatccacgacgggaaccgggagttcggcgagtacctcgcccaccgccgcggcggcgag
ggcaacgactgggacggaacccgggtgcgggccctggtccccgtccggcaccccgtcgta
cgggtgcaccccgagaccggccggcgctcgctcttcgtgaacccgggcttcaccgtgcgg
atcgccggggtgagcgacgccgagagccggggactcctggatatcttcttcgcgcacctc
acccggcccgagcacctggttcgtcaccactggcggccgggcgacgtcgtcctctgggac
aaccggagcaccgcccactacgccgaccacgactacggcgacttccaacggatcatgcac
cgcatcaccctccgcggcgacatcccagtcggcccggaccccgcggcgcgaccttccgct
cgaacctga

DBGET integrated database retrieval system