Fervidobacterium riparium: IB67_06305 Help Entry IB67_06305        CDS       T08552                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism frr  Fervidobacterium riparium Pathway frr02024   Quorum sensing frr03018   RNA degradation Brite KEGG Orthology (KO) [BR:frr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     IB67_06305  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     IB67_06305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:frr03019]     IB67_06305    03036 Chromosome and associated proteins [BR:frr03036]     IB67_06305 Messenger RNA biogenesis [BR:frr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      IB67_06305 Chromosome and associated proteins [BR:frr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     IB67_06305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Spore_YhaL LSM EndoS_Ig-like Motif Other DBs NCBI-ProteinID:  UXF01161 LinkDB All DBs Position complement(1357662..1357958) Genome browser AA seq 98 aa AA seqDB search MPKEKAKEKFNLQDRFLNIVRTRKIEVKVYLVNGFQAKGIVRSFDNFTVLLESGKQQTLI YKHAISTILPSEYIMLMKTEEEEQKEEQEAQESEGEQI NT seq 297 nt NT seq  +upstreamnt  +downstreamnt gtgccaaaggaaaaggcaaaggaaaagttcaaccttcaggacagatttttgaacattgtt agaacaaggaagatagaagttaaagtttacttagttaacggatttcaggctaagggtatt gttagatcattcgataatttcacggttttattggagagtggtaaacagcaaactttaatt tacaaacatgccattagtacgattttgccttctgaatacataatgctaatgaagaccgaa gaagaggaacagaaggaagaacaagaggctcaggaaagcgaaggcgaacagatataa

DBGET integrated database retrieval system