Falco rusticolus (gyrfalcon): 119159250 Help Entry 119159250         CDS       T11606                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism frs  Falco rusticolus (gyrfalcon) Pathway frs04382   Cornified envelope formation frs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:frs00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     119159250 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119159250 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:frs04147]     119159250 (S100A10) Exosome [BR:frs04147]  Exosomal proteins   Exosomal proteins of microglial cells    119159250 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  119159250 NCBI-ProteinID:  XP_037267813 LinkDB All DBs Position 19:355963..358741 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETLMFTFHKYAGDKNHLGKEDLRALMEKEFPGFLENQQDPMALDKIMKDLD QCRDGKVGFQGFFSLVAGLTIACNDYFVLHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtcccagatggagcacgccatggagaccctcatgttcaccttccacaagtacgcg ggtgacaagaaccacctgggcaaggaggacctgcgggcgctgatggagaaggagttcccc ggcttcctggagaaccagcaggacccgatggccctggacaagatcatgaaggacctggac cagtgccgggacggcaaggtgggcttccagggcttcttctcgctggtggccgggctcacc atcgcctgcaacgactactttgtcctgcacatgaagcagaagggcaggaagtga

DBGET integrated database retrieval system