Fructobacillus americanaquae: M3M36_05780 Help Entry M3M36_05780       CDS       T08234                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fru  Fructobacillus americanaquae Pathway fru01100   Metabolic pathways fru01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fru00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M3M36_05780    00074 Mycolic acid biosynthesis     M3M36_05780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M3M36_05780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  USS91820 UniProt:  A0ABY5BZ81 LinkDB All DBs Position 1174725..1174973 Genome browser AA seq 82 aa AA seqDB search MAFTKEQIYDRLAKEAAQRFSLKAEKVSPNLNFAQDTSADSIDVVELVLEVEDEYNMEIP DEALDSLTTLQKVVDYVYVHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcatttacaaaagaacagatttatgaccggttagcaaaggaagccgcccaacggttt tcattaaaggctgagaaggttagtcccaatctgaactttgctcaggatacatcggctgat tcaattgacgtggttgagttggtcttagaggttgaagatgaatataacatggaaattcca gacgaagcgttggattccttgacgacgttacaaaaggtcgtggattacgtctatgttcac caggcgtaa

DBGET integrated database retrieval system