Frondihabitans sucicola: GCM10025867_27800 Help Entry GCM10025867_27800 CDS       T09158                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism fsb  Frondihabitans sucicola Pathway fsb03060   Protein export fsb03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:fsb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GCM10025867_27800  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GCM10025867_27800  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:fsb02044]     GCM10025867_27800 Secretion system [BR:fsb02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GCM10025867_27800 SSDB OrthologParalogGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BDZ50539 UniProt:  A0ABM8GQJ3 LinkDB All DBs Position complement(2583770..2584027) Genome browser AA seq 85 aa AA seqDB search MFGNAFGWPHLLIILVILLLLFGAPKLPALAKSIAQSMKIFRTEMGPNSGNAASNGSSAA PTAGTTNTSTDDTNPASSTDLPPKP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgttcggtaacgcctttggttggccccacctactcatcatcctcgtgatcctgctgctg ctcttcggtgcgccgaagctcccggcactcgcgaagagcatcgcccagtcgatgaagatc ttccgcaccgagatgggccccaactccggtaacgccgcgtcgaacggaagcagtgctgct cccacggccggcaccaccaacacgtcgaccgacgacaccaacccggcgtcgtcgaccgac cttccgccgaagccgtag

DBGET integrated database retrieval system