Flavobacterium sediminis: DI487_02670 Help Entry DI487_02670       CDS       T06625                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fse  Flavobacterium sediminis Brite KEGG Orthology (KO) [BR:fse00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fse03032]     DI487_02670    03036 Chromosome and associated proteins [BR:fse03036]     DI487_02670    03400 DNA repair and recombination proteins [BR:fse03400]     DI487_02670 DNA replication proteins [BR:fse03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DI487_02670 Chromosome and associated proteins [BR:fse03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DI487_02670 DNA repair and recombination proteins [BR:fse03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DI487_02670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AWM12877 UniProt:  A0A2U8QRU1 LinkDB All DBs Position 559859..560131 Genome browser AA seq 90 aa AA seqDB search MNKSELIDAMAASAGITKAAAKLALESFLSNVEGTLKKGGRVSLVGFGSWSVSKRAAREG RNPQTGKTIKIAAKNVVKFKAGAELDNAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatcagaattaatcgatgcaatggctgcttctgccggtatcactaaagcagct gctaaattagctttagaatcatttttaagcaatgttgaaggtactctaaaaaaaggtggt agagtttctttagtaggtttcggatcttggtcggtttctaaaagagctgccagagaaggt agaaatcctcaaactggtaaaacaattaaaatcgctgctaaaaacgttgtgaaattcaaa gctggtgctgagcttgacaacgcagtaaactaa

DBGET integrated database retrieval system