Frateuria soli: LQ771_08780 Help Entry LQ771_08780       CDS       T08854                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fsg  Frateuria soli Pathway fsg01100   Metabolic pathways fsg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fsg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LQ771_08780 (acpP)    00074 Mycolic acid biosynthesis     LQ771_08780 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LQ771_08780 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UGB36936 LinkDB All DBs Position complement(1912882..1913121) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVIEQLGVKEDEVTANASFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQQAVDYIKAHTKD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaagatcgtcatcgagcagctgggcgtgaaggaa gacgaagtcacggcgaacgcttcgttcgtggacgacctgggcgccgattcgctggacacg gtggaactggtgatggccctcgaggaagagttcgagaccgagatcccggacgaggaagcc gagaagatcaccaccgttcagcaggccgtggattacatcaaggcccacaccaaggactga

DBGET integrated database retrieval system