Candidatus Fukatsuia symbiotica: CCS41_11535 Help Entry CCS41_11535       CDS       T06003                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fsm  Candidatus Fukatsuia symbiotica Pathway fsm00998   Biosynthesis of various antibiotics fsm01100   Metabolic pathways fsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCS41_11535    00074 Mycolic acid biosynthesis     CCS41_11535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCS41_11535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AWK14958 UniProt:  A0A2U8I739 LinkDB All DBs Position 2414840..2415079 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIIVEQLSVTEKEVTLASSFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAVDYITAHQGT NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgtgttaagaagatcatcgttgaacaactgagtgttacagaa aaagaggttactttagcgtcttcttttgtggatgatcttggcgcggattccctggatacc gtcgaattggtaatggctctggaagaagaatttgatactgagattccagacgaagaagcg gagaagattacaacggttcaggcagctgttgactatatcacagcacatcagggcacataa

DBGET integrated database retrieval system