Francisella salimarina: KQR59_08075 Help Entry KQR59_08075       CDS       T07516                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fsr  Francisella salimarina Pathway fsr01100   Metabolic pathways fsr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fsr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KQR59_08075    00074 Mycolic acid biosynthesis     KQR59_08075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KQR59_08075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SID ACP_SdgA_C DUF4468 Motif Other DBs NCBI-ProteinID:  QWU99048 UniProt:  A0AAJ4NN43 LinkDB All DBs Position 1642020..1642274 Genome browser AA seq 84 aa AA seqDB search MSFSKEQIFAQLQDILNNLFEIDKDDVTLDSTLYEDLDLDSIDAVDLVVQLQNFTGRKFK PEEFKSVRTVGDVVDTIIAALAQD NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttttctaaagaacaaattttcgcacaattacaggatattcttaataatcttttt gaaatagataaggatgatgtcactctagattcaacactatacgaagatcttgatttagat agtattgatgctgttgatttagtagtacaactgcaaaacttcacaggtcgcaagtttaaa cctgaggaatttaaatctgttcgtactgttggggatgttgttgacactataattgcagct ctagcacaagactaa

DBGET integrated database retrieval system