Fervidobacterium thailandense: U0O82_02365 Help Entry U0O82_02365       CDS       T11134                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fthl  Fervidobacterium thailandense Pathway fthl00020   Citrate cycle (TCA cycle) fthl00720   Other carbon fixation pathways fthl01100   Metabolic pathways fthl01110   Biosynthesis of secondary metabolites fthl01120   Microbial metabolism in diverse environments fthl01200   Carbon metabolism fthl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:fthl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     U0O82_02365   09102 Energy metabolism    00720 Other carbon fixation pathways     U0O82_02365 Enzymes [BR:fthl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      U0O82_02365 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_2 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_17 Fer4_6 Fer4_8 LdpA_Fe-S-bd Fer4_13 Fer4_3 Fer4_15 Fer4_18 EXPB1_D1 Motif Other DBs NCBI-ProteinID:  XEY14586 LinkDB All DBs Position 494426..494656 Genome browser AA seq 76 aa AA seqDB search MPKKKFKVMVKYEWCKACGICYHICPTKTIVRGELNRPDIPDHSTCIGCLMCENLCPDFA IDVVEEKSEEVGVENA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgccaaagaagaaattcaaggttatggtaaaatatgaatggtgcaaggcgtgtggtatt tgctatcacatctgtccaacgaaaaccatcgtgcgtggtgaattgaacaggccggatatt ccggatcattccacgtgcatcggctgtctgatgtgcgaaaacttgtgccctgactttgca atagacgttgttgaagaaaagagtgaagaggtaggtgtcgaaaatgcctaa

DBGET integrated database retrieval system