Fervidobacterium thailandense: U0O82_03090
Help
Entry
U0O82_03090 CDS
T11134
Name
(GenBank) F0F1 ATP synthase subunit epsilon
KO
K02114
F-type H+-transporting ATPase subunit epsilon
Organism
fthl Fervidobacterium thailandense
Pathway
fthl00190
Oxidative phosphorylation
fthl01100
Metabolic pathways
Module
fthl_M00157
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:
fthl00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
U0O82_03090
09180 Brite Hierarchies
09181 Protein families: metabolism
00194 Photosynthesis proteins [BR:
fthl00194
]
U0O82_03090
Photosynthesis proteins [BR:
fthl00194
]
Photosystem and electron transport system
F-type ATPase [OT]
U0O82_03090
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP-synt_DE_N
Motif
Other DBs
NCBI-ProteinID:
XEY14717
LinkDB
All DBs
Position
complement(635752..636045)
Genome browser
AA seq
97 aa
AA seq
DB search
MRVKIVTPTKIMDFKDVKFLVFRTVDGEMGVLDRRAPIIAKLAVADVKLKLENSEESYRV
VDGFLHCDGKSNVVILTEEVGKPEDFDPHRYLGNMAQ
NT seq
294 nt
NT seq
+upstream
nt +downstream
nt
atgagggtaaaaattgtaacaccaaccaagatcatggacttcaaagatgttaagttcctc
gtattcagaacggtcgacggtgagatgggagttctggacaggcgagcacccattatcgca
aagctggcggtggcggatgtaaagctaaagctggaaaattccgaagaatcctacagggtt
gtcgatggttttttacattgcgatgggaagagcaacgttgtgatcctgactgaagaagtg
ggaaaaccggaggattttgacccacacagatacctcggaaacatggcccagtga
DBGET
integrated database retrieval system