Fervidobacterium thailandense: U0O82_08260 Help Entry U0O82_08260       CDS       T11134                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fthl  Fervidobacterium thailandense Pathway fthl01100   Metabolic pathways fthl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fthl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U0O82_08260    00074 Mycolic acid biosynthesis     U0O82_08260   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U0O82_08260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XEY13870 LinkDB All DBs Position complement(1735496..1735747) Genome browser AA seq 83 aa AA seqDB search MEREELFQKVAEIISEKLNIPIEDIDEDSHLIEDLGADSLDAFDLVMVFEDEFGIKLEDA EIENLLTVKDIVDLLSKKLAEQE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggaaagagaagaactcttccagaaggttgccgaaataatctccgaaaaactcaacatc cccattgaggacatcgacgaagattctcacttgatcgaagatctcggggccgattccctt gatgcgttcgaccttgttatggtattcgaagacgaattcggtatcaaacttgaggatgcg gagatagaaaacctcttaaccgtcaaagatatcgttgatttactctccaaaaaactcgcc gagcaggagtga

DBGET integrated database retrieval system