Faecalibacterium taiwanense: PXT33_006605 Help Entry PXT33_006605      CDS       T10210                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ftk  Faecalibacterium taiwanense Pathway ftk01100   Metabolic pathways ftk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ftk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PXT33_006605 (acpP)    00074 Mycolic acid biosynthesis     PXT33_006605 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PXT33_006605 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XBA11495 LinkDB All DBs Position complement(1292959..1293195) Genome browser AA seq 78 aa AA seqDB search MDTFEKIRALLAEQLDVDPAKITMDSDIMSDFEADSLDIVDMVMTLEDEFGIEVPDDAIE SLRTVGDVVNFVDSHAQN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggatacttttgaaaaaatccgtgcattgctggcggagcagctggatgttgacccggca aagatcacgatggacagtgacatcatgagcgattttgaggccgacagtctggatatcgtg gatatggtgatgacgctggaggatgagtttggcattgaggtgccggacgatgccatcgag tccctgcgcaccgtgggcgatgtggtaaactttgtggacagccacgcgcagaactga

DBGET integrated database retrieval system