Fusobacterium varium: FV113G1_01160 Help Entry FV113G1_01160     CDS       T05280                                  Name (GenBank) putative DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fva  Fusobacterium varium Brite KEGG Orthology (KO) [BR:fva00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fva03032]     FV113G1_01160    03036 Chromosome and associated proteins [BR:fva03036]     FV113G1_01160    03400 DNA repair and recombination proteins [BR:fva03400]     FV113G1_01160 DNA replication proteins [BR:fva03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FV113G1_01160 Chromosome and associated proteins [BR:fva03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FV113G1_01160 DNA repair and recombination proteins [BR:fva03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FV113G1_01160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 Spectrin_5 HU-CCDC81_euk_2 HROB DASH_Duo1 Motif Other DBs NCBI-ProteinID:  BBA49770 LinkDB All DBs Position 138686..138955 Genome browser AA seq 89 aa AA seqDB search MNKRELAKVYSEMSKGEISARKALKEIEVFLETMQEALEKSHSLMFRNIGIFEVKERKSR IIANPVTRELMKIYPKKIVKFRVFKSIVK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaataagagagaattagcaaaagtatacagtgaaatgagtaaaggggaaatatcagca agaaaagcactgaaagaaatagaagtatttcttgaaacaatgcaggaggctttggagaaa agtcattcattgatgtttagaaatataggaatatttgaagtgaaggaaagaaaatccaga ataatagccaatccagtaactagagaattaatgaaaatatatccaaagaaaatagtaaag tttagagtatttaaaagtatagtcaaataa

DBGET integrated database retrieval system