Fragaria vesca (woodland strawberry): 101294584 Help Entry 101294584         CDS       T02666                                  Name (RefSeq) polyubiquitin 9   KO K03873   elongin-B Organism fve  Fragaria vesca (woodland strawberry) Pathway fve04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:fve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101294584  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fve04121]     101294584    03400 DNA repair and recombination proteins [BR:fve03400]     101294584 Ubiquitin system [BR:fve04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101294584    Cul5 complex      101294584 DNA repair and recombination proteins [BR:fve03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101294584 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N UBL_UBAC1 GABP-alpha DUF2604 Ubiquitin_2 Ubiquitin_5 Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  101294584 NCBI-ProteinID:  XP_004287147 LinkDB All DBs Position LG1:complement(1005722..1007899) Genome browser AA seq 103 aa AA seqDB search MAMYIRVKRSKTTYFIQCEPTETILDIKQKLQNLIDQSVNDQRLILVSTGAVLDDSKTLA DQKVENDGIVALTLRKDDDEFEEVNIVRPDDFYQSRDGDAGSW NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggccatgtatatccgtgttaagcgtagtaagacaacgtactttatccagtgtgaacca actgagacaattttagatattaagcagaaattgcaaaatcttattgatcaatcagtaaat gatcagcgcttgatcctagtcagtactggcgcagtactggatgattcaaagacattggca gatcagaaggtggaaaatgatggcattgtagcactgaccttgagaaaagatgatgatgag tttgaagaagtgaacattgtgcgaccagatgacttctaccaatctcgtgatggagatgct ggcagttggtga

DBGET integrated database retrieval system