Fragaria vesca (woodland strawberry): 101296981 Help Entry 101296981         CDS       T02666                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve04136   Autophagy - other Brite KEGG Orthology (KO) [BR:fve00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     101296981  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101296981    04121 Ubiquitin system [BR:fve04121]     101296981    03029 Mitochondrial biogenesis [BR:fve03029]     101296981 Membrane trafficking [BR:fve04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     101296981 Ubiquitin system [BR:fve04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    101296981 Mitochondrial biogenesis [BR:fve03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     101296981 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-GeneID:  101296981 NCBI-ProteinID:  XP_004303685 LinkDB All DBs Position LG6:24351282..24353453 Genome browser AA seq 95 aa AA seqDB search MSSTESPTAAKKVVIHLRATGDAPILKQAKFKIPGTDKFAKVIDFLRRQLHRDTLFVYVN SAFSPNPDELVMDLYNNFGFDGKLVVNYACSMAWG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaacggaatctccgactgctgctaagaaagtggttattcatctcagagctact ggtgatgcccctattctgaagcaagccaaattcaagatacctggaactgacaagtttgct aaagtgatagactttttgaggaggcaacttcaccgggatacgttgtttgtgtatgtcaat agtgcattctcgccaaacccagatgaattggtgatggatctatataataattttggtttt gatggtaaactggtggtcaactatgcttgttccatggcgtggggctaa

DBGET integrated database retrieval system