Fragaria vesca (woodland strawberry): 101297640 Help Entry 101297640         CDS       T02666                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism fve  Fragaria vesca (woodland strawberry) Pathway fve04016   MAPK signaling pathway - plant fve04070   Phosphatidylinositol signaling system fve04075   Plant hormone signal transduction fve04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:fve00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     101297640    04070 Phosphatidylinositol signaling system     101297640    04075 Plant hormone signal transduction     101297640  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     101297640  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:fve01009]     101297640   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101297640    03036 Chromosome and associated proteins [BR:fve03036]     101297640   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fve04147]     101297640 Protein phosphatases and associated proteins [BR:fve01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101297640 Membrane trafficking [BR:fve04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101297640 Chromosome and associated proteins [BR:fve03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101297640 Exosome [BR:fve04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101297640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 DUF5580_M RNA_pol_Rpb4 EFhand_Ca_insen Caleosin EF-hand_11 TerB SPEF2_C FCaBP_EF-hand Temptin_C Phage_TAC_12 Mu-like_Pro MecA_N MotA_activ AAA_assoc_C Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  101297640 NCBI-ProteinID:  XP_004299498 LinkDB All DBs Position LG5:9793286..9795512 Genome browser AA seq 149 aa AA seqDB search MTEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ NGTIDFSEFLNLMARKMKDTDSEEELREAFKVFDKDQNGYISAAELRHVMANLGEKLTDE EVDEMIREADEDGDGQVNYDEFVRMMLNK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgacggagcagctgacggaggagcagatcgccgagttcaaggaagccttttgcctcttc gacaaagacggtgatggttgcatcactaccaaggaattggggactgtgatgagatctctg gggcaaaatcccactgaagctgaattgcaagacatgatcaatgaggttgatgccgaccag aacggcacaattgatttttctgaattcctgaatttgatggctaggaaaatgaaggatacc gattctgaggaggaactaagagaagccttcaaggtctttgataaggatcagaatggctat atttctgctgcagagcttcgacatgtaatggcaaaccttggagagaaactgactgatgag gaagtggatgagatgattcgcgaagcagatgaagatggtgatggccaggtgaactatgac gagtttgtcaggatgatgcttaacaaatga

DBGET integrated database retrieval system