Fragaria vesca (woodland strawberry): 101302518 Help Entry 101302518         CDS       T02666                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve04145   Phagosome fve04148   Efferocytosis fve04620   Toll-like receptor signaling pathway fve05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:fve00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101302518    04148 Efferocytosis     101302518  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101302518  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101302518  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101302518   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fve04147]     101302518    04031 GTP-binding proteins [BR:fve04031]     101302518 Membrane trafficking [BR:fve04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101302518  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101302518   Macropinocytosis    Ras GTPases     101302518  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101302518 Exosome [BR:fve04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101302518   Exosomal proteins of other body fluids (saliva and urine)    101302518   Exosomal proteins of colorectal cancer cells    101302518   Exosomal proteins of bladder cancer cells    101302518 GTP-binding proteins [BR:fve04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101302518 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  101302518 NCBI-ProteinID:  XP_011459838 LinkDB All DBs Position LG2:23151336..23152774 Genome browser AA seq 163 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLALWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDEQFFMDHAGAVPISSAQVNTAASPQKLISVYLSMRLIF NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctccaggttcataaagtgcgtgacggtcggcgacggcgccgtcgggaaaacc tgtatgctgatttcctacaccagcaacaccttccctaccgactatgtgccgactgtgttc gacaatttcagcgctaatgttgtggtggatggaagcacagtcaaccttgccctgtgggac accgcagggcaggaggattacaatagattacgacccttgagctatcgaggtgcagatgtt ttcatacttgctttctctctgattagcaaagccagctatgaaaatgtcgccaaaaagtgg attcctgagctgcggcattatgcacctggtgttccaattattcttgttggaaccaagctt gatcttcgtgatgatgaacaattctttatggaccatgctggtgcagtgcccatctccagt gctcaggtaaatactgcggcttctcctcaaaagctaatctctgtttacttgtctatgaga ttgattttctag

DBGET integrated database retrieval system