KEGG   Fragaria vesca (woodland strawberry): 101302986
Entry
101302986         CDS       T02666                                 

Name
(RefSeq) anthocyanidin 5,3-O-glucosyltransferase
  KO
K12938  anthocyanidin 5,3-O-glucosyltransferase [EC:2.4.1.-]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00942  Anthocyanin biosynthesis
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00942 Anthocyanin biosynthesis
    101302986
Enzymes [BR:fve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     101302986
SSDB
Motif
Pfam: UDPGT Cerato-platanin HHV6-IE Glyco_tran_28_C
Other DBs
NCBI-GeneID: 101302986
NCBI-ProteinID: XP_004308036
LinkDB
Position
LG7
AA seq 471 aa
MGGGSDAIVLYPYPGLGHLISMVELGKLLLTHHPSFSITILASTAPTTIAATAKLVASSN
DQLTNYIKAVSATNPAINFHHLPIISLPENVNKQNLPFEYARLQIPNILQTLTSNTKALI
LDMFCDALFDVAKDLNIPTFFFYTSAGRSLAVLINIPTFHRTVNSLSDYGDTPISIPGMP
PLPVTTLPKLLFDRSTNFYKSFLSMSTHMAISDGIILNTFDLLEERALKALRAGLCLPNQ
PTPPIFTVGPLISGRSGDNDEHESLKWLNNQPKDSVVFLCFGSMGVFSIKQLEAMALGLE
KSGQRFLWVVRNPPIEELGVEDPSLEDILPKGFVERTKERGLVVRKWAPQVEVLSHDSVG
GFVTHCGWNSVLEAVCNGVPMVAWPLYAEQKLSRIFLVEEMKVAVGVKENETGFVSAEEL
EKKVKELMDSERGEEIRGRVLEFRNGGVKAKEEGGSSIASLAELAQLWKQN
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgggtggaggtagtgatgctattgttttgtatccatatccaggactaggtcacctgatt
tccatggtagagcttggcaagctcttactcactcaccacccttctttctccatcacaatc
ctcgcctctaccgccccgaccaccatcgccgccacagccaagctcgtcgccagctccaac
gatcagttaacaaactacatcaaagccgtctctgccaccaaccccgccatcaacttccac
cacctcccaatcatttctctcccagaaaacgtcaacaagcaaaacctccctttcgaatat
gcacgtctccaaatccccaacatcctccaaaccctaacctcaaacactaaagcccttatt
ctcgacatgttttgcgacgcattattcgacgttgcgaaagacctaaacatccctacattc
ttcttctacacctcagccggaagaagcctcgccgtcctaatcaacatccctaccttccat
cgcacagtcaacagtctttcggactacggcgacacccccatttccattcccggcatgcct
ccccttcctgtcacaacactgcctaagctcttgttcgaccgctctactaatttctacaag
agcttcctgtcaatgtcaactcacatggcaatctcggatgggatcattctcaacacgttt
gatttgcttgaagagagagctctcaaggcgttgagggctggactgtgcttgcctaaccag
cccacacctccgatcttcaccgtcggaccgttgatctccgggaggagtggagataatgac
gagcatgaaagcttgaagtggctaaacaaccagcctaaagacagcgttgtgtttctatgt
ttcggaagcatgggagtttttagtatcaaacaattggaggcaatggctttagggttagag
aaaagtgggcagaggttcttgtgggtggtacgtaatccacctatagaagagttgggagta
gaggaccctagtttggaggatatattaccaaagggttttgtggagagaacaaaggagagg
ggactggtggtgaggaagtgggcgccgcaggtggaggtactgagtcatgactcggtggga
gggtttgtgactcactgcggatggaactcggttttggaggcagtgtgtaatggggtgcct
atggtggcgtggcctttgtacgcggagcagaagctgagcagaatttttttggtggaggag
atgaaggtggctgtgggggtgaaagagaatgaaacagggttcgtgagtgcggaagagttg
gagaagaaagtgaaggagttgatggactcggagagaggggaggaaataagagggagggtt
ttggagttcagaaatggtggcgtgaaggccaaggaagaaggtgggtcttctattgcttcc
ttggccgagttggctcagttgtggaagcaaaactaa

DBGET integrated database retrieval system