Fragaria vesca (woodland strawberry): 101304527 Help Entry 101304527         CDS       T02666                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve03083   Polycomb repressive complex fve04120   Ubiquitin mediated proteolysis fve04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101304527    04120 Ubiquitin mediated proteolysis     101304527   09126 Chromosome    03083 Polycomb repressive complex     101304527  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101304527    04121 Ubiquitin system [BR:fve04121]     101304527    03036 Chromosome and associated proteins [BR:fve03036]     101304527 Membrane trafficking [BR:fve04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101304527 Ubiquitin system [BR:fve04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      101304527    Cul7 complex      101304527 Chromosome and associated proteins [BR:fve03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101304527   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101304527 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  101304527 NCBI-ProteinID:  XP_004289997 LinkDB All DBs Position LG2:6856787..6857251 Genome browser AA seq 154 aa AA seqDB search MSTETKKILVLHTADNETFEIEEAVVLQSQTIKHMVEDECADNAIPLPNVTSKTLSKVLE YCKKHAEDSGEGGEEALRAWDADFVNFDTDTLYDVIMAANYLNIKSLLDLTCQRVADMCK GKTPEEIRNTFNIKNDFSPEEEEAVRRENQWAFE NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtctactgaaacgaagaagatactagtcctgcataccgcggacaatgagactttcgag attgaagaggcggtggtcctccaatcccagacgataaaacacatggtggaggacgaatgt gccgacaacgccattcctttacctaatgtcaccagtaagaccctctctaaggtgctcgag tactgcaagaagcacgcagaggattccggcgagggcggcgaggaggctctcagggcatgg gacgcagatttcgtcaacttcgacacggacacactctatgatgtcatcatggcagccaac tatttgaacatcaagagcttgctggacctgacctgccagagagtcgcggacatgtgcaag ggaaagactcctgaagagattcgaaatactttcaacatcaagaacgacttcagtcctgaa gaagaagaggccgttcggagggagaaccaatgggcctttgagtga

DBGET integrated database retrieval system