Fragaria vesca (woodland strawberry): 101309501 Help Entry 101309501         CDS       T02666                                  Name (RefSeq) calmodulin-like protein 8   KO K02183   calmodulin Organism fve  Fragaria vesca (woodland strawberry) Pathway fve04016   MAPK signaling pathway - plant fve04070   Phosphatidylinositol signaling system fve04075   Plant hormone signal transduction fve04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:fve00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     101309501    04070 Phosphatidylinositol signaling system     101309501    04075 Plant hormone signal transduction     101309501  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     101309501  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:fve01009]     101309501   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101309501    03036 Chromosome and associated proteins [BR:fve03036]     101309501   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fve04147]     101309501 Protein phosphatases and associated proteins [BR:fve01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101309501 Membrane trafficking [BR:fve04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101309501 Chromosome and associated proteins [BR:fve03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101309501 Exosome [BR:fve04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101309501 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 SPARC_Ca_bdg EH TerB SPEF2_C EF_EFCAB10_C Dockerin_1 Caleosin RNA_pol_Rpb4 PA_Ig-like TMP_3 SurA_N_3 CSN8_PSD8_EIF3K MinC_N_1 DUF5580_M Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  101309501 NCBI-ProteinID:  XP_004290639 LinkDB All DBs Position LG2:complement(16209859..16211260) Genome browser AA seq 147 aa AA seqDB search MAEALTETQIAEFQEAFCLIDKDSDGVITLEELASVIQSLDERPTKEEVQDMISEISADV TGTIDFDEFLSIMARKMQENVAEELKEAFKVFDRDQDGYISASELRQVMINLGERLSNEE AEQMIREADFDGDGLVSYEEFARMMLS NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcagaagctttaacagaaacccagattgctgagttccaggaagccttttgtctcatt gacaaggattcagatggggtaattaccttggaagaactagcctctgtgatccaatcacta gatgaacgaccgacgaaggaagaagttcaagacatgattagtgagattagtgctgatgta actggcacaatagattttgatgagttcttgagtatcatggctaggaagatgcaggaaaat gttgctgaggagctaaaagaagcattcaaagtatttgacagggatcaagatggttatatt tcagcttctgagttgagacaggtgatgataaacttgggagaaagattgagcaatgaagag gcagagcaaatgatcagagaggctgattttgatggtgacggtctggttagctatgaagaa tttgcaaggatgatgctcagctag

DBGET integrated database retrieval system