Fragaria vesca (woodland strawberry): 101313331 Help Entry 101313331         CDS       T02666                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism fve  Fragaria vesca (woodland strawberry) Brite KEGG Orthology (KO) [BR:fve00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:fve03041]     101313331   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fve04052]     101313331 Spliceosome [BR:fve03041]  Complex B   Other components    Complex B specific factors     101313331 Cytokines and neuropeptides [BR:fve04052]  Neuropeptides   Unclassified    101313331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Ubiquitin_4 OTU1_UBXL Rad60-SLD Crinkler Motif Other DBs NCBI-GeneID:  101313331 NCBI-ProteinID:  XP_004304434 LinkDB All DBs Position LG6:34730293..34732951 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVKVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNVYKDHITLRDY EVHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctgaacgatcgtctggggaagaaggtgaaggtgaagtgcaacgag gacgacaccatcggcgacctgaagaagctggtggctgcccagacgggtacccgagccgat aagatccggatccagaagtggtacaacgtctacaaggaccacatcactctccgcgactac gaagtccatgacggcatgggcctcgagctctactacaactga

DBGET integrated database retrieval system