Fragaria vesca (woodland strawberry): 101313658 Help Entry 101313658         CDS       T02666                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve04145   Phagosome fve04148   Efferocytosis fve04620   Toll-like receptor signaling pathway fve05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:fve00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101313658    04148 Efferocytosis     101313658  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101313658  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101313658  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101313658   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fve04147]     101313658    04031 GTP-binding proteins [BR:fve04031]     101313658 Membrane trafficking [BR:fve04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101313658  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101313658   Macropinocytosis    Ras GTPases     101313658  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101313658 Exosome [BR:fve04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101313658   Exosomal proteins of other body fluids (saliva and urine)    101313658   Exosomal proteins of colorectal cancer cells    101313658   Exosomal proteins of bladder cancer cells    101313658 GTP-binding proteins [BR:fve04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101313658 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  101313658 NCBI-ProteinID:  XP_004289869 LinkDB All DBs Position LG2:5107124..5110179 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFTDHPGAVPITTAQGEELKKTIGAPIYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAHNACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggttcataaagtgtgtcactgttggggatggagcggtgggcaagact tgtatgctcatctcttacaccagcaacactttcccaacggattacgtgcctactgtgttt gacaatttcagtgcaaatgtggttgtggatgggagcacagtgaacttggggttgtgggat actgctgggcaggaagattacaatagactaagaccattgagctaccgtggggcagatgtg ttcttacttgcattctctctaatcagcaaggccagctatgaaaatgttgccaagaagtgg attcctgaattgaagcattatgcacctggtgttccgattattcttgttggaacaaagctt gatcttcgcgatgacaagcagttctttacagatcatcctggtgcagtgccaattaccaca gctcagggagaggaacttaaaaaaacaattggagctccgatttacatagaatgtagctcg aaaacacagcagaatgtgaaagcggtctttgatgcggcgattaaagtggttctgcagccg ccaaagcagaagaagaaaaagaagagaaaggcacacaatgcctgctctatattgtaa

DBGET integrated database retrieval system