Fragaria vesca (woodland strawberry): 101313658 Help Entry 101313658         CDS       T02666                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve04145   Phagosome fve04148   Efferocytosis fve04517   IgSF CAM signaling fve04518   Integrin signaling fve04620   Toll-like receptor signaling pathway fve05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:fve00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101313658    04518 Integrin signaling     101313658  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101313658    04148 Efferocytosis     101313658  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101313658  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101313658  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101313658   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fve04147]     101313658    04031 GTP-binding proteins [BR:fve04031]     101313658 Membrane trafficking [BR:fve04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101313658  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101313658   Macropinocytosis    Ras GTPases     101313658  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101313658 Exosome [BR:fve04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101313658   Exosomal proteins of other body fluids (saliva and urine)    101313658   Exosomal proteins of colorectal cancer cells    101313658   Exosomal proteins of bladder cancer cells    101313658 GTP-binding proteins [BR:fve04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101313658 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  101313658 NCBI-ProteinID:  XP_004289869 LinkDB All DBs Position LG2:5107124..5110179 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFTDHPGAVPITTAQGEELKKTIGAPIYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAHNACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggttcataaagtgtgtcactgttggggatggagcggtgggcaagact tgtatgctcatctcttacaccagcaacactttcccaacggattacgtgcctactgtgttt gacaatttcagtgcaaatgtggttgtggatgggagcacagtgaacttggggttgtgggat actgctgggcaggaagattacaatagactaagaccattgagctaccgtggggcagatgtg ttcttacttgcattctctctaatcagcaaggccagctatgaaaatgttgccaagaagtgg attcctgaattgaagcattatgcacctggtgttccgattattcttgttggaacaaagctt gatcttcgcgatgacaagcagttctttacagatcatcctggtgcagtgccaattaccaca gctcagggagaggaacttaaaaaaacaattggagctccgatttacatagaatgtagctcg aaaacacagcagaatgtgaaagcggtctttgatgcggcgattaaagtggttctgcagccg ccaaagcagaagaagaaaaagaagagaaaggcacacaatgcctgctctatattgtaa

DBGET integrated database retrieval system