Fragaria vesca (woodland strawberry): 101315103 Help Entry 101315103         CDS       T02666                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve03083   Polycomb repressive complex fve04120   Ubiquitin mediated proteolysis fve04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101315103    04120 Ubiquitin mediated proteolysis     101315103   09126 Chromosome    03083 Polycomb repressive complex     101315103  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101315103    04121 Ubiquitin system [BR:fve04121]     101315103    03036 Chromosome and associated proteins [BR:fve03036]     101315103 Membrane trafficking [BR:fve04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101315103 Ubiquitin system [BR:fve04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      101315103    Cul7 complex      101315103 Chromosome and associated proteins [BR:fve03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101315103   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101315103 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Peptidase_C3 Motif Other DBs NCBI-GeneID:  101315103 NCBI-ProteinID:  XP_004308771 LinkDB All DBs Position LG7:complement(14790875..14791261) Genome browser AA seq 128 aa AA seqDB search MSKVVRFQSSNKEVLEAAECMVTMSKTIQTMLNRFQEDQVIMLPLEQVDSKTLTMVREWC ENHVTKSTQKQYQFVEGLDVDVLLLLLKTANYLNIKELGDDMREAIAERARRKALEEIDP RILHTRVF NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaggtcgtgagattccagagctcgaacaaagaagtattagaagcagccgagtgc atggtaactatgtccaaaaccattcagacaatgctgaataggttccaagaagaccaggtg atcatgcttccactagagcaggtggattccaaaaccctaaccatggtaagagaatggtgt gagaatcacgtcacgaagagtacccaaaaacagtaccaatttgtggaggggctcgatgtt gacgttctcttgcttctcctcaaaactgcaaactatctcaacatcaaggagttgggagat gatatgcgcgaagcgatcgcggagagggctcgtaggaaagcacttgaagagatcgatccg agaattctccatactcgggtgttttga

DBGET integrated database retrieval system