Fragaria vesca (woodland strawberry): 10251492 Help Entry 10251492          CDS       T02666                                  Symbol atpH, FvH4_C0014 Name (RefSeq) ATP synthase CF0 subunit III   KO K02110   F-type H+-transporting ATPase subunit c Organism fve  Fragaria vesca (woodland strawberry) Pathway fve00190   Oxidative phosphorylation fve00195   Photosynthesis fve01100   Metabolic pathways Module fve_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:fve00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     10251492 (atpH)    00195 Photosynthesis     10251492 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:fve00194]     10251492 (atpH) Photosynthesis proteins [BR:fve00194]  Photosystem and electron transport system   F-type ATPase [OT]    10251492 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  10251492 NCBI-ProteinID:  YP_004286089 UniProt:  F1KLA9 LinkDB All DBs Position Pltd:complement(13318..13563) Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctggattggctgtcgggcttgct tctattggacctggggttggtcaaggtactgctgcgggacaggctgtagaagggatcgcg agacaaccagaggcggaaggaaaaatacggggtactttattgcttagtctagctttcatg gaagctttaacaatttatgggctggttgtagcattagctcttttatttgcgaatcctttt gtttaa

DBGET integrated database retrieval system