Fragaria vesca (woodland strawberry): 105351216 Help Entry 105351216         CDS       T02666                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism fve  Fragaria vesca (woodland strawberry) Brite KEGG Orthology (KO) [BR:fve00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fve03036]     105351216   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fve04147]     105351216 Chromosome and associated proteins [BR:fve03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105351216 Exosome [BR:fve04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105351216 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Bromo_TP Motif Other DBs NCBI-GeneID:  105351216 NCBI-ProteinID:  XP_011463296 LinkDB All DBs Position LG1 Genome browser AA seq 87 aa AA seqDB search MNKGKYQKSTELLIHKLPFQRLVREIAHDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTN LCAIHAKRVTIMPKDIQLARRTRGERA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaataaagggaaataccagaagagtacggagcttctgatccacaagttgccgttccag aggcttgtgagggagattgctcatgacttcaagactgatctccggttccaaagcagcgcc gtggccgcgcttcaggaggcggcggaggcttaccttgtgggtctgtttgaggacactaac ctctgtgcaattcacgccaagagggtcaccattatgcccaaggatattcagcttgccagg agaaccagaggcgaaagggcttag

DBGET integrated database retrieval system