Fragaria vesca (woodland strawberry): 105353211 Help Entry 105353211         CDS       T02666                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve03083   Polycomb repressive complex fve04120   Ubiquitin mediated proteolysis fve04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105353211    04120 Ubiquitin mediated proteolysis     105353211   09126 Chromosome    03083 Polycomb repressive complex     105353211  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     105353211    04121 Ubiquitin system [BR:fve04121]     105353211    03036 Chromosome and associated proteins [BR:fve03036]     105353211 Membrane trafficking [BR:fve04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     105353211 Ubiquitin system [BR:fve04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      105353211    Cul7 complex      105353211 Chromosome and associated proteins [BR:fve03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      105353211   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      105353211 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BAF250_C GT-D-like Motif Other DBs NCBI-GeneID:  105353211 NCBI-ProteinID:  XP_011470468 LinkDB All DBs Position LG7 Genome browser AA seq 161 aa AA seqDB search MSASAENEASTKQESGPSGAVQDDQKKITVRTGDGEVFELNEEVAMEMETIKTFYQEDDK CETVTMPLPNVERWELQKVIEYCSKYLELKNKEDFDRKLKVFQAEFIKSLSPKCLLCLAN TANYLDIQYLQDFICQSVADHIKNKDVEYVRELFEVENDFV NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtcagcttcagcagagaacgaggcctccaccaagcaagagagcggcccctccggcgcc gtccaagatgaccagaagaagatcacggtacggactggagatggcgaggtctttgagttg aacgaagaggtggcaatggagatggaaaccatcaagaccttttaccaggaggacgataag tgtgagacggttaccatgcccttgccaaatgtggagagatgggagttgcagaaagtcata gagtactgcagcaagtatctcgagctcaagaacaaggaagacttcgacaggaaactcaag gtcttccaggctgagttcatcaagagcttgagccctaagtgtctactgtgcctcgccaac acggccaattacttggacatccaatatctgcaagacttcatctgtcagtccgttgcggat catattaagaataaggatgtcgaatatgtgagggagctctttgaagtggagaatgacttt gtttga

DBGET integrated database retrieval system