Frieseomelitta varia: 122527565 Help Entry 122527565         CDS       T09482                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism fvi  Frieseomelitta varia Pathway fvi04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:fvi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122527565  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:fvi04121]     122527565    03400 DNA repair and recombination proteins [BR:fvi03400]     122527565 Ubiquitin system [BR:fvi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      122527565    Cul5 complex      122527565 DNA repair and recombination proteins [BR:fvi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      122527565 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Lin1244_N Motif Other DBs NCBI-GeneID:  122527565 NCBI-ProteinID:  XP_043507794 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKIPPVNQQLFNKDNVLMSDSKFLSD YGLTSATAKPQCPALVGLAVRQENGQFEPLEMTPFSLPPDLPDVMKSQEANGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttctaatgattcggcgaaaaaatatgacgatatttactgatgccaaagat aatacgacagttcttgaacttaaaaaaattatagaaggtatattaaaaataccacctgtg aatcaacagctgttcaacaaggacaatgttctaatgtcagatagtaaatttttatctgat tatggattaacatcggcaactgcaaaaccacaatgccctgcattagtaggattagctgta cgtcaagaaaatggtcaatttgaacctttagagatgacaccattctcattaccacctgat ttaccagatgtcatgaaatctcaagaagctaacggacaggaacaatcaccttga

DBGET integrated database retrieval system