Fusarium venenatum: FVRRES_01112 Help Entry FVRRES_01112      CDS       T09539                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism fvn  Fusarium venenatum Pathway fvn04145   Phagocytosis fvn04517   IgSF CAM signaling fvn04814   Motor proteins Brite KEGG Orthology (KO) [BR:fvn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     FVRRES_01112  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     FVRRES_01112   09142 Cell motility    04814 Motor proteins     FVRRES_01112  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fvn03037]     FVRRES_01112    04812 Cytoskeleton proteins [BR:fvn04812]     FVRRES_01112 Cilium and associated proteins [BR:fvn03037]  Motile cilia and associated proteins   Dynein arm    FVRRES_01112 Cytoskeleton proteins [BR:fvn04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      FVRRES_01112 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light SGTA_dimer Cwc21_C Motif Other DBs NCBI-GeneID:  37252756 NCBI-ProteinID:  XP_025588320 UniProt:  A0A2L2TTI7 LinkDB All DBs Position I:<3091854..>3092540 Genome browser AA seq 103 aa AA seqDB search MADAHAPKAESPVPREKLEAQIKSADMTEDMQQESIEVAQEAMAKFTIEKDIAQHIKRTF DERKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggccgacgctcacgctcccaaggcagagtctcccgttccccgggagaagctcgaggct cagatcaagtccgccgatatgacggaggatatgcaacaagaatccatcgaagttgctcag gaggccatggccaagttcaccattgagaaggatattgcacagcacatcaagcgaaccttc gacgagcgaaagggacctacttggcactgcattgttggacgcaactttggcagctttgtc actcacgagaccaagcacttcatctacttctaccttggccactgcgcaattttactattc aaaacgcaatag

DBGET integrated database retrieval system