Fusarium venenatum: FVRRES_01847 Help Entry FVRRES_01847      CDS       T09539                                  Name (RefSeq) uncharacterized protein   KO K09481   protein transport protein SEC61 subunit beta Organism fvn  Fusarium venenatum Pathway fvn03060   Protein export fvn04141   Protein processing in endoplasmic reticulum fvn04145   Phagosome Brite KEGG Orthology (KO) [BR:fvn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     FVRRES_01847    04141 Protein processing in endoplasmic reticulum     FVRRES_01847  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     FVRRES_01847  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fvn04131]     FVRRES_01847   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:fvn02044]     FVRRES_01847 Membrane trafficking [BR:fvn04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     FVRRES_01847 Secretion system [BR:fvn02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    FVRRES_01847 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  37253491 NCBI-ProteinID:  XP_025589055 LinkDB All DBs Position I:5225601..5226119 Genome browser AA seq 115 aa AA seqDB search MKLSSPRPSSPVNGGAAASGANIGRPSSPAIPGGPRTAIRRRAAADQKEKIANARPSSTR AAGAGGSSSTMLRLYTDESPGLKVDPVVVLVLSLVFIFSVVALHIIAKITRKFSS NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaagctttcttctcctcgtccttcctcccccgtcaacggcggcgctgctgccagcggt gccaacatcggccgaccctcatctcctgctatccctggtggtccccgtactgccatccga cgacgcgctgccgccgaccagaaggagaagattgccaatgctcgaccaagcagcactcgc gccgctggcgccggtggttccagcagcaccatgctgcgactttacaccgatgagtcgccc ggtcttaaggtcgaccccgtcgttgtccttgttctgtctcttgtctttatcttcagcgtt gttgctcttcacattatcgccaagattacccgaaagttctccagctaa

DBGET integrated database retrieval system