Fusarium venenatum: FVRRES_07076 Help Entry FVRRES_07076      CDS       T09539                                  Name (RefSeq) uncharacterized protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism fvn  Fusarium venenatum Pathway fvn03020   RNA polymerase fvn03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fvn00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FVRRES_07076   09124 Replication and repair    03420 Nucleotide excision repair     FVRRES_07076  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fvn03021]     FVRRES_07076    03400 DNA repair and recombination proteins [BR:fvn03400]     FVRRES_07076 Transcription machinery [BR:fvn03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FVRRES_07076   RNA polymerase III system    RNA polymerase III      FVRRES_07076   RNA polymerase I system    RNA polymerase I      FVRRES_07076 DNA repair and recombination proteins [BR:fvn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FVRRES_07076 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPAB4 Zn_Ribbon_YjdM zf-C2HC5 Zn_ribbon_IS1595 Zn_ribbon_8 Zn_ribbon_19 DUF7129 DUF7130 DZR DnaJ_CXXCXGXG Rv1322 Motif Other DBs NCBI-GeneID:  37258715 NCBI-ProteinID:  XP_025586360 UniProt:  A0A2L2TPK6 LinkDB All DBs Position II:<6881225..>6881497 Genome browser AA seq 72 aa AA seqDB search MPREEYQIPTASTGQRGGTRDDHQVRHVMAYICGDCGGSVTLGKDALVACPHCAGRILYK ERTKRMVQFEAR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgcctcgcgaagagtaccaaattcctaccgcctctaccggccagcgtggcggtacccgc gacgaccaccaggttcgtcatgtcatggcctacatctgcggtgactgcggcggcagcgtc accctcggcaaggatgctcttgtcgcctgccctcactgcgccggtcgcattctttacaag gagcgaaccaagcgtatggtgcagtttgaggcccgatag

DBGET integrated database retrieval system