Fusarium venenatum: FVRRES_11561 Help Entry FVRRES_11561      CDS       T09539                                  Name (RefSeq) uncharacterized protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism fvn  Fusarium venenatum Pathway fvn03018   RNA degradation fvn03040   Spliceosome Brite KEGG Orthology (KO) [BR:fvn00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     FVRRES_11561   09123 Folding, sorting and degradation    03018 RNA degradation     FVRRES_11561  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:fvn03019]     FVRRES_11561    03041 Spliceosome [BR:fvn03041]     FVRRES_11561 Messenger RNA biogenesis [BR:fvn03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      FVRRES_11561   mRNA degradation factors    5'-3' decay     Lsm complex      FVRRES_11561 Spliceosome [BR:fvn03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     FVRRES_11561 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  37263194 NCBI-ProteinID:  XP_025581262 LinkDB All DBs Position IIII:complement(<1422974..>1423497) Genome browser AA seq 102 aa AA seqDB search MASQLLPLELIDKCVGSRIWVIMKGDKGKTSVCCQERRCTDELAEFSGTLVGFDDYVNMV LEDVTEFDYSGNHTKLPKILLNGNNICMLIPGGEGPEGAASG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggcctcccaactgctacccctcgagcttatcgacaagtgtgttggctcgagaatttgg gtcatcatgaagggcgataagggtaagacgagtgtttgctgtcaagagaggcgttgtact gatgagctggcagaattcagtggaacactcgttggattcgatgactacgtcaacatggtt ctggaggacgtgactgagtttgattactcgggaaaccacaccaagctacccaagattcta ctcaacggtaacaacatttgcatgttgatccccggtggtgagggcccagaaggggctgct tcaggttga

DBGET integrated database retrieval system