Fusarium verticillioides: FVEG_00649 Help Entry FVEG_00649        CDS       T04869                                  Name (RefSeq) dynein light chain, cytoplasmic   KO K10418   dynein light chain LC8-type Organism fvr  Fusarium verticillioides Pathway fvr04145   Phagocytosis fvr04517   IgSF CAM signaling fvr04814   Motor proteins Brite KEGG Orthology (KO) [BR:fvr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     FVEG_00649  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     FVEG_00649   09142 Cell motility    04814 Motor proteins     FVEG_00649  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:fvr03037]     FVEG_00649    04812 Cytoskeleton proteins [BR:fvr04812]     FVEG_00649 Cilium and associated proteins [BR:fvr03037]  Motile cilia and associated proteins   Dynein arm    FVEG_00649 Cytoskeleton proteins [BR:fvr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      FVEG_00649 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light SGTA_dimer Cwc21_C Motif Other DBs NCBI-GeneID:  30059002 NCBI-ProteinID:  XP_018742947 UniProt:  W7LDV5 LinkDB All DBs Position 1:complement(<4324826..>4325498) Genome browser AA seq 103 aa AA seqDB search MADAHVPKAESPVAREKLEAQIKSADMTEDMQQESIEVAQEAMAKFTIEKDIAQHIKRTF DERKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggccgacgctcacgttcccaaggcagagtctcccgtcgctcgggagaagcttgaggct cagatcaagtccgccgacatgacggaggatatgcaacaggagtctatcgaagttgcccag gaagccatggccaagttcaccattgagaaggacatcgcacagcacatcaagcgcacattc gacgagcgaaagggaccaacctggcactgcattgttggccgaaatttcggtagcttcgtt acccacgagaccaagcactttatctacttttaccttggccactgcgcaattctactattc aaaacgcaatag

DBGET integrated database retrieval system