Fusarium verticillioides: FVEG_17040 Help Entry FVEG_17040        CDS       T04869                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism fvr  Fusarium verticillioides Pathway fvr00510   N-Glycan biosynthesis fvr00513   Various types of N-glycan biosynthesis fvr01100   Metabolic pathways fvr04141   Protein processing in endoplasmic reticulum Module fvr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:fvr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     FVEG_17040    00513 Various types of N-glycan biosynthesis     FVEG_17040  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     FVEG_17040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  30073916 NCBI-ProteinID:  XP_018759117 UniProt:  W7MPC6 LinkDB All DBs Position 7:2351772..2352685 Genome browser AA seq 48 aa AA seqDB search MISDNDLYRLAIFFGTTAMILIVLYHFLEVNAAKDPIEAGKEGASKSL NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atgatctcagacaacgatctctacagactcgccattttcttcggcactacagcaatgatt ctcattgttctctaccatttcctcgaagtcaacgctgcgaaagatccgattgaagccggc aaggagggagcgtcaaaatcactgtaa

DBGET integrated database retrieval system