Fructilactobacillus vespulae: R4B61_03105 Help Entry R4B61_03105       CDS       T11124                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fvs  Fructilactobacillus vespulae Pathway fvs01100   Metabolic pathways fvs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fvs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R4B61_03105    00074 Mycolic acid biosynthesis     R4B61_03105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R4B61_03105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 DUF1953 Motif Other DBs NCBI-ProteinID:  XNW45293 LinkDB All DBs Position 685303..685554 Genome browser AA seq 83 aa AA seqDB search MAEKVSNEQILAEIKEIVEDQTDIDAAKITMDANFKDTLDLDSLDIFEIVDALEDKYDIE IDGDDGITTVAELVDYVAKKVNA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggctgaaaaagtaagtaatgaacaaatcttagcagaaatcaaagaaatcgttgaagat caaactgatattgacgctgctaaaatcacaatggatgctaacttcaaagatactttagat cttgatagtttagatatttttgaaatcgtagatgctctagaagacaaatacgatatcgaa attgacggtgatgatggaattaccactgttgcagaattagttgactacgttgctaaaaag gtaaacgcctaa

DBGET integrated database retrieval system